DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and LOC312273

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:231 Identity:92/231 - (39%)
Similarity:134/231 - (58%) Gaps:16/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTS---EF 109
            |.|||||:.......|:||||...|||||||:|:::|:|:||||.:    .:|:||||..   |.
  Rat    22 DDRIVGGYTCQEHSVPYQVSLNAGSHICGGSLITDQWVLSAAHCYH----PQLQVRLGEHNIYEI 82

  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMD--GEACFVS 172
            ..:.|.:...|::.|..::...||.|..|::|..|...:.....:.||:    |..  |..|.||
  Rat    83 EGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQ----YCPTAGTECLVS 143

  Fly   173 GWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            |||..:...||...|:.::.|:::..:|.:.|.:.  :|..|.|.||||||||:||.|||||:|.
  Rat   144 GWGVLKFGFESPSVLQCLDAPVLSDSVCHKAYPRQ--ITNNMFCLGFLEGGKDSCQYDSGGPVVC 206

  Fly   238 ESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
             :||:.|:||||.|||....||||::|....:||.:
  Rat   207 -NGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 89/225 (40%)
Tryp_SPc 51..274 CDD:238113 90/228 (39%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 90/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.