DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CG14780

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:262 Identity:92/262 - (35%)
Similarity:131/262 - (50%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LSPRLDGRIVGGHRINITDAPHQVSLQT--------SSHICGGSIISEEWILTAAHCTYGKTADR 99
            |......||:.|......:..|.||::.        |.|||||::|:...:||||||.|.....|
  Fly    25 LQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKR 89

  Fly   100 LK------VRLGT-SEFA-RSGQLL-RVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDE------ 149
            .:      |.||| :.|. |:|.:: :|..:.....|:..::..|..:|.|...:....      
  Fly    90 FRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHL 154

  Fly   150 TKKAVKLPESQMKYMDGEACFVSGWGNTQ-----NLLESREWLRQVEVPLVNQELCSEKYKQYGG 209
            |...::| ..|:. ..|:.|.|:|||.|:     |:|.:      ..|..:..:.|...|:  .|
  Fly   155 TVAPIQL-AGQIT-PPGKLCQVAGWGRTEQSSLSNILLT------ANVSTIRHQTCRMIYR--SG 209

  Fly   210 VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            :...|:|||.|:||.|:||||||||:|.| |.||||||||||||:|..||||..|.:.|.||:..
  Fly   210 LLPGMMCAGRLQGGTDSCQGDSGGPLVHE-GRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIEGR 273

  Fly   275 SG 276
            ||
  Fly   274 SG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 87/248 (35%)
Tryp_SPc 51..274 CDD:238113 88/250 (35%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 87/248 (35%)
Tryp_SPc 33..271 CDD:238113 87/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.