DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss30

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:269 Identity:99/269 - (36%)
Similarity:137/269 - (50%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QRSLEDVIKNPWKLSPRLD---------GRIVGGHRINITDAPHQVSL--QTSSHICGGSIISEE 83
            :||......|.|.....|.         |:||||........|.||||  ....||||||:|.|.
Mouse    44 RRSYAGFFYNGWARGDILPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEV 108

  Fly    84 WILTAAHC---TYGKTADRLKV-RLGTSEFARSGQLLRVQKIVQHAQFNYTNVDY-DFSLLQLAH 143
            |:||||||   :...:...:|| .|..|.......|:.|:.|..|..:.:.:... |.:|:||..
Mouse   109 WVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDT 173

  Fly   144 PIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYG 208
            |::..:. ..|.||.:|.....|..|:|:|||.||. .:....|:::.|||::.|.|.:.|...|
Mouse   174 PLRPSQF-TPVCLPAAQTPLTPGTVCWVTGWGATQE-RDMASVLQELAVPLLDSEDCEKMYHTQG 236

  Fly   209 G-------VTERMICAGFLEGGKDACQGDSGGPMV---SESGELVGVVSWGYGCAKPDYPGVYSR 263
            .       :...|:|||::||.||:||||||||:|   :.|...||:.|||.|||:|..||||:|
Mouse   237 SSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTR 301

  Fly   264 VSFARDWIK 272
            |....|||:
Mouse   302 VPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/237 (38%)
Tryp_SPc 51..274 CDD:238113 93/239 (39%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 93/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.