DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk8

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:251 Identity:85/251 - (33%)
Similarity:127/251 - (50%) Gaps:20/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VIKNPWKLSPRLDG-RIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTAD 98
            ::...|....|..| :|:.|........|.|.:| |....:|||.::.:.|:||||||    ..|
  Rat    17 LLMGAWAGLTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHC----KKD 77

  Fly    99 RLKVRLGTSEFARSG---QLLRVQKIVQHAQFNYTNVD---YDFSLLQLAHPIKFDETKKAVKLP 157
            :..||||.....:..   |.::|.:.:||..||.:|.:   :|..|::|.:.....:..|.::|.
  Rat    78 KYSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSHDIMLIRLQNSANLGDKVKPIELA 142

  Fly   158 ESQMKYMDGEACFVSGWGNTQNLLES-REWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLE 221
            ....|.  |:.|.:||||...:..|: ...|...||.:.:|..|...|.  |.:||.|:||| ..
  Rat   143 NLCPKV--GQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYP--GKITEGMVCAG-SS 202

  Fly   222 GGKDACQGDSGGPMVSESGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWIKEHSG 276
            .|.|.||||||||:|. :|.|.|:.|||.. |.||:.||||:::....:|||:..|
  Rat   203 NGADTCQGDSGGPLVC-NGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWIKKTMG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 78/229 (34%)
Tryp_SPc 51..274 CDD:238113 81/231 (35%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 78/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.