DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Tpsg1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:275 Identity:100/275 - (36%)
Similarity:136/275 - (49%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CSLLVLAGV--CLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSS-H 73
            |..|:|..|  |..|| |....|                 ||||||.......|.|.||:... |
  Rat     7 CGFLLLLAVPGCGQPQ-VSHAGS-----------------RIVGGHAAQAGAWPWQASLRLQKVH 53

  Fly    74 ICGGSIISEEWILTAAHCTYGK-TADRLKVRLGTSEFARSGQLLRVQKIVQHAQF-NYTNVDYDF 136
            :||||::|.||:||||||..|. .:...:|.||......|.....|::|:.::.. .......|.
  Rat    54 VCGGSLLSPEWVLTAAHCFSGSVNSSDYEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDI 118

  Fly   137 SLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQ--NLLESREWLRQVEVPLVNQEL 199
            :|:|||.|:......:.|.|||:...:..|..|:|:|||.||  ..|:....|::.:|.:|:.|.
  Rat   119 ALVQLATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVET 183

  Fly   200 CSEKYKQYGG--VTERMICAGFLEGGKDACQGDSGGPMVSESG---ELVGVVSWGYGCAKPDYPG 259
            ||:.|....|  :...|:||.   |..||||.|||||:|....   :..||||||.||.:||.||
  Rat   184 CSQAYSSSNGSLIQSDMLCAW---GPGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPG 245

  Fly   260 VYSRVSFARDWIKEH 274
            ||:||:...:||..|
  Rat   246 VYARVTAYVNWIHRH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 88/230 (38%)
Tryp_SPc 51..274 CDD:238113 89/232 (38%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 88/230 (38%)
Tryp_SPc 30..260 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.