DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss22

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:244 Identity:82/244 - (33%)
Similarity:139/244 - (56%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVS-LQTSSHICGGSIISEEWILTAAHCTYGKTADR---LKVRLG 105
            |:...|:|||........|..|| |:..||.|.||:::..|:::|||| :....|:   ..|.||
  Rat    44 PQQLNRVVGGEDSADAQWPWIVSILKNGSHHCAGSLLTNRWVVSAAHC-FSSNMDKPSPYSVLLG 107

  Fly   106 TSEFARSG---QLLRVQKIVQHAQFNYTNVDY-DFSLLQLAHPIKFDETKKAVKLPESQMKYMDG 166
            ..:....|   |.:.:..::.|.:::.....: |.:|::|..||:|.|....:.||:|.:.....
  Rat   108 AWKLGNPGPRSQKVGIASVLPHPRYSRKEGTHADIALVRLERPIQFSERILPICLPDSSVHLPPN 172

  Fly   167 EACFVSGWGNTQN--LLESREWLRQVEVPLVNQELCSEKYKQYGG---VTERMICAGFLEGGKDA 226
            ..|:::|||:.|:  .|...:.|::::||:::.|||...|.:..|   :||.|:|||:|||.:||
  Rat   173 TNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYLEGKRDA 237

  Fly   227 CQGDSGGPMVSESGE---LVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            |.||||||::.:..:   |.|::|||.|||:.:.||||:.:...|.|::
  Rat   238 CLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAHRPWVQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 80/236 (34%)
Tryp_SPc 51..274 CDD:238113 80/238 (34%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 80/236 (34%)
Tryp_SPc 50..288 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.