DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and GZMK

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:235 Identity:77/235 - (32%)
Similarity:127/235 - (54%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVGGHRINITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCTYGKTADRL-KVRLGTSEFAR-- 111
            |:||..::....|...|:|... |:|||.:|..:|:||||||.|..|..:. .|.||....::  
Human    27 IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNE 91

  Fly   112 -SGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWG 175
             |.|.|.::|.:..::........|..|::|....|.::..|.:.: .|:.....|..|.|:|||
Human    92 ASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHI-RSKTSLRSGTKCKVTGWG 155

  Fly   176 NTQ-NLLESREWLRQVEVPLVNQELC-SEKYKQYGG---VTERMICAGFLEGGKDACQGDSGGPM 235
            .|. :.|...:.||:|.|.:::::|| |:.|  |.|   :|:.|:|||..:|.||:|:||||||:
Human   156 ATDPDSLRPSDTLREVTVTVLSRKLCNSQSY--YNGDPFITKDMVCAGDAKGQKDSCKGDSGGPL 218

  Fly   236 VSESGELVGVVSWGYGCAKPDYPGVYSRVSFA-RDWIKEH 274
            :.: |....:||.|:.|.....||:|:.::.. :.|||.:
Human   219 ICK-GVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 74/230 (32%)
Tryp_SPc 51..274 CDD:238113 77/233 (33%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 74/230 (32%)
Tryp_SPc 27..257 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.