DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk11

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:296 Identity:92/296 - (31%)
Similarity:132/296 - (44%) Gaps:71/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VKRQRSLEDVIKNPWKLS--PRLDG----------------------------RIVGGHRINITD 61
            ::|.|.|    |:.||||  ||..|                            ||:.|:......
  Rat     1 MRRPRRL----KSDWKLSTEPREPGARPALLQAMMILRFIALALVTGHVGGETRIIKGYECRPHS 61

  Fly    62 APHQVSL-QTSSHICGGSIISEEWILTAAHC------------TYGKTADRLKVRLGTSEFARSG 113
            .|.||:| |.:..:||.::|:.:|:||||||            ...||....:.|:.|..|    
  Rat    62 QPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESF---- 122

  Fly   114 QLLRVQKIVQHAQFNYT--NVDY--DFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
                     .|..||.:  |.|:  |..|::::.|...  |:....|..|.:....|.:|.:|||
  Rat   123 ---------PHPGFNNSLPNKDHRNDIMLVKMSSPAFI--TRAVRPLTLSSLCVTAGTSCLISGW 176

  Fly   175 GNTQN-LLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSE 238
            |.|.: .|.....||...|.::..:.|...|.  |.:|:.|:||...:.|||:||||||||:|. 
  Rat   177 GTTSSPQLRLPHSLRCANVSIIGHKECERAYP--GNITDTMLCASVRKEGKDSCQGDSGGPLVC- 238

  Fly   239 SGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWIKE 273
            :|.|.|::|||.. ||....||||::|....|||.|
  Rat   239 NGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWIHE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 78/239 (33%)
Tryp_SPc 51..274 CDD:238113 80/242 (33%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 78/239 (33%)
Tryp_SPc 51..275 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.