DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk6

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:262 Identity:88/262 - (33%)
Similarity:128/262 - (48%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSSH-ICGGSIISEE 83
            :|||            :.|:.|  |...|..:.||..:. ...|.|.:|.||.| :|||.::..:
  Rat    13 LCLI------------LAKSAW--SEDQDKVVHGGPCLK-NSHPFQAALYTSGHLLCGGVLVGPQ 62

  Fly    84 WILTAAHCTYGKTADRLKVRLG------TSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLA 142
            |:||||||    ....|:|.||      |..|.|.   :.|.:.:.|.::|....|.|..::.|.
  Rat    63 WVLTAAHC----KKPNLEVYLGKHNLRQTETFQRQ---ISVDRTIVHPRYNPQTHDNDIMMVHLK 120

  Fly   143 HPIKFDETKKAVKL-PESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQ 206
            .|:||.:..:.:.| .:...|..|   |.:.|||..:| .|..:.::..:|.||::|.|...|. 
  Rat   121 RPVKFSQRIQPLPLKKDCSEKNPD---CQILGWGKMEN-GEFPDTIQCADVQLVSREECERAYP- 180

  Fly   207 YGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWG-YGCAKPDYPGVYSRVSFARDW 270
             |.:|..|:|||....|.|:||||||||:|. .|.|.|:|||| ..|...:.||||:.|.....|
  Rat   181 -GKITRSMVCAGDKREGNDSCQGDSGGPLVC-GGHLRGIVSWGDMPCGSKEKPGVYTDVCTHIRW 243

  Fly   271 IK 272
            |:
  Rat   244 IQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 79/229 (34%)
Tryp_SPc 51..274 CDD:238113 81/231 (35%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 79/230 (34%)
Tryp_SPc 29..247 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.