DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss38

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:279 Identity:83/279 - (29%)
Similarity:136/279 - (48%) Gaps:29/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIPQPVKRQRSLEDVIKNPWK--------------LS-----PRLDGRIVGGHRINITDAPHQVS 67
            |.|.|.....::.....:||.              ||     |.|.|:::||........|.|||
  Rat    66 LSPGPAPPHSNIRCPFLHPWPPLLWCGREPSLHLFLSSACGQPALHGKLLGGELTIDRKWPWQVS 130

  Fly    68 LQTSS-HICGGSIISEEWILTAAHC-TYGKTADRLKVRLGTSEFA---RSGQLLRVQKIVQHAQF 127
            :..:. |:|||||::..|:|||||| ...|......:.:|.:...   :..|...:.:::.|..|
  Rat   131 IHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTF 195

  Fly   128 N-YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVE 191
            . :..|..|.:|:|....|.|.:....:.||.|.:...| .:|:.:|||......|:.:.|.:.:
  Rat   196 EMFHPVGGDVALVQSKSAIVFSDYVLPICLPSSNLNLSD-LSCWTTGWGMVSPQGETGKDLLEAQ 259

  Fly   192 VPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGEL---VGVVSWGYGCA 253
            :||:.:..|...|.....:...|:|||.::..|:.|:||||.|:|.:..:.   :|:||||.|||
  Rat   260 LPLIPKFQCQLLYGLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCA 324

  Fly   254 KPDYPGVYSRVSFARDWIK 272
            :|.||||::.||:..:||:
  Rat   325 QPLYPGVFANVSYFLNWIR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 71/229 (31%)
Tryp_SPc 51..274 CDD:238113 73/231 (32%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 72/227 (32%)
Tryp_SPc 116..342 CDD:214473 71/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.