DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss34

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:300 Identity:97/300 - (32%)
Similarity:139/300 - (46%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFVLLQC-------------SLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRI 57
            ||:.|.|             .|:.:.|.|    ||...|.       ||::|.|.          
  Rat     9 LFLTLPCLGSTMPLTPDSGQELVGIVGGC----PVSASRF-------PWQVSLRF---------- 52

  Fly    58 NITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGK--TADRLKVRLGTSEFARSGQLLRVQK 120
                  :.:.|....||||||:|..:|:||||||...|  .|...:|::|......:.||::|.|
  Rat    53 ------YNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAK 111

  Fly   121 IVQHAQFN---YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLE 182
            |::|.:|:   ......|.:||:|...:...|....|.||.:..:....:..:|:|||    ::|
  Rat   112 IIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWG----VIE 172

  Fly   183 SRE------WLRQVEVPLVNQELCSEKYKQYGG-------VTERMICAGFLEGGKDACQGDSGGP 234
            ...      .||:|.||:|....|.:||:.|..       :.:.|:|||.  .|:|:||.|||||
  Rat   173 GHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGM--EGRDSCQADSGGP 235

  Fly   235 MVSE---SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            :|..   |...|||||||.||..||:||||:||.....||
  Rat   236 LVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 81/241 (34%)
Tryp_SPc 51..274 CDD:238113 82/241 (34%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 91/275 (33%)
Tryp_SPc 33..275 CDD:214473 90/274 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.