DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss30

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:246 Identity:97/246 - (39%)
Similarity:134/246 - (54%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GRIVGGHRINITDAPH-----QVSLQT--SSHICGGSIISEEWILTAAHC---TYGKTADRLKV- 102
            |:||||.     |||.     ||||:|  ..||||||:|.|.|:||||||   ....:...:|| 
  Rat    29 GKIVGGQ-----DAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVG 88

  Fly   103 RLGTSEFARSGQLLRVQKIVQHAQFNYTNVDY-DFSLLQLAHPIKFDETKKAVKLPESQMKYMDG 166
            .|..|.......|:.|:.|..:..:.:.:... |.:||:|..|::..:. ..|.||::|.....|
  Rat    89 GLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQPSQF-SPVCLPQAQAPLTPG 152

  Fly   167 EACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKY----KQYGG---VTERMICAGFLEGGK 224
            ..|:|:|||.|.. .|....|:::.|||::.|.|...|    ....|   :...|:||||:||.|
  Rat   153 TVCWVTGWGATHE-RELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQK 216

  Fly   225 DACQGDSGGPMV---SESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            |:||||||||:|   :.|...||:.|||.|||:|:.||||:||....|||:
  Rat   217 DSCQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 94/242 (39%)
Tryp_SPc 51..274 CDD:238113 96/244 (39%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.