DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and LOC286960

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:231 Identity:97/231 - (41%)
Similarity:135/231 - (58%) Gaps:14/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTS-SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF-- 109
            |.:||||:.......|:||||... ||.||||:||::|:|:|||| |.:   :|:||||....  
  Rat    21 DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHC-YKR---KLQVRLGEHNIHV 81

  Fly   110 ARSG-QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG 173
            ...| |.:..:||::|.::|...:|.|..|::|..|...:.....|.||.| ....|.: |.|||
  Rat    82 LEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRS-CASTDAQ-CLVSG 144

  Fly   174 WGNTQNLLESREWLRQ-VEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            ||||.::......|.| :|.|:::...|.:.|.  |.:|..|.|.||||||||:|.||||||:|.
  Rat   145 WGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP--GQITSNMFCLGFLEGGKDSCDGDSGGPVVC 207

  Fly   238 ESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
             :||:.|:||||..||....||||::|.....||:|
  Rat   208 -NGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 93/225 (41%)
Tryp_SPc 51..274 CDD:238113 96/228 (42%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 93/225 (41%)
Tryp_SPc 24..243 CDD:238113 96/228 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.