DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK9

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:279 Identity:89/279 - (31%)
Similarity:126/279 - (45%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQCSLL-VLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL-QTSS 72
            |.|:|| :|||                   :.|     .|.|.:|.........|.|..| ..:.
Human     5 LLCALLSLLAG-------------------HGW-----ADTRAIGAEECRPNSQPWQAGLFHLTR 45

  Fly    73 HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTS---EFARSGQLLRVQKIVQHAQFN----YT 130
            ..||.::||:.|:||||||    ....|.||||..   ::....||.||.....|..||    ..
Human    46 LFCGATLISDRWLLTAAHC----RKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSAN 106

  Fly   131 NVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQV----- 190
            :.:.|..|::|....:.....:.:.|  ||.....|..|.:||||    .:.|.:.|..|     
Human   107 DHNDDIMLIRLPRQARLSPAVQPLNL--SQTCVSPGMQCLISGWG----AVSSPKALFPVTLQCA 165

  Fly   191 EVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWG-YGCAK 254
            .:.::..:||...|.  |.:::.|:|||..|||:.:||||||||:|. :|.|.||||.| ..|::
Human   166 NISILENKLCHWAYP--GHISDSMLCAGLWEGGRGSCQGDSGGPLVC-NGTLAGVVSGGAEPCSR 227

  Fly   255 PDYPGVYSRVSFARDWIKE 273
            |..|.||:.|....|||:|
Human   228 PRRPAVYTSVCHYLDWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/234 (33%)
Tryp_SPc 51..274 CDD:238113 79/237 (33%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.