DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss43

DIOPT Version :10

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_955765.1 Gene:Prss43 / 272643 MGIID:2684822 Length:382 Species:Mus musculus


Alignment Length:243 Identity:82/243 - (33%)
Similarity:127/243 - (52%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GHRINITDA---------PHQVSLQT-SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT-- 106
            ||||...|.         |.|||||: :.|:||||:||..|:||||||.|.:  :...|.||.  
Mouse   113 GHRITEVDPGSLSAGRKWPWQVSLQSQNEHVCGGSLISHRWVLTAAHCIYEQ--EEYMVMLGDDM 175

  Fly   107 --SEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEAC 169
              || :.|..|:.||.|:..:.|:...:..|.:|..|..|:.:....:.|.|||...:..:|..|
Mouse   176 LHSE-SESVTLVPVQDIIFPSNFDIQTMRNDIALALLYFPVNYSSLIQPVCLPEEPFRVKNGTVC 239

  Fly   170 FVSGWGNTQNLLE---SREWLRQVEVPLVNQELCSEKYKQYGG-----VTERMICAGFLEGGKDA 226
            :|:|||. ||.::   :...|::|:..::.|:.|:..:::..|     |.:.||| |..:.|:..
Mouse   240 WVTGWGQ-QNEIDAGFASILLQEVQQRILLQKHCNTLFQRQLGTSKNLVIKGMIC-GLQDSGQSL 302

  Fly   227 CQGDSGGPMVSESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            |.||||.|:|.||...   ||::|||..|.......||:.::...:|:
Mouse   303 CWGDSGNPLVCESDNTWTQVGIMSWGINCNGVPVLSVYTDIAEYNEWV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 82/243 (34%)
Prss43NP_955765.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..97
Tryp_SPc 117..351 CDD:238113 78/239 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.