DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Tpsg1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:240 Identity:90/240 - (37%)
Similarity:127/240 - (52%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCTYGK-TADRLKVRLGTSEFARS 112
            ||||||.......|.|.||:... |:||||::|.||:||||||..|. .:...:|.||......|
Mouse    86 RIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTVTLS 150

  Fly   113 GQLLRVQKIVQHAQFNYT------NVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFV 171
            .....|::|:.     ||      ....|.:|:||:.|:......:.|.|||:...:..|..|:|
Mouse   151 PHFSTVKRIIM-----YTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWV 210

  Fly   172 SGWGNT--QNLLESREWLRQVEVPLVNQELCSEKYKQYGG--VTERMICAGFLEGGKDACQGDSG 232
            :|||.|  ...|:....|::.:|.:|:.:.||:.|....|  :...|:||   .|..||||.|||
Mouse   211 TGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCA---RGPGDACQDDSG 272

  Fly   233 GPMVSE---SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            ||:|.:   :.:..||||||.||.:||.||||:||:...:||..|
Mouse   273 GPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 87/235 (37%)
Tryp_SPc 51..274 CDD:238113 88/237 (37%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 88/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.