DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS33

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:246 Identity:93/246 - (37%)
Similarity:133/246 - (54%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PRLDGRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHCTYGKTA--DRLKVRLGT 106
            ||:..|||||......:.|.|.|:| ..:|:||||:|:.:|:|||||| :.:.|  ...:||||.
Human    31 PRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHC-FPRRALPAEYRVRLGA 94

  Fly   107 SEFARSGQ---LLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
            .....:..   .:.|::::....::......|.:||||..|:......:.|.||....:...|..
Human    95 LRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTP 159

  Fly   169 CFVSGWGNTQNLLESREW--LRQVEVPLVNQELCSEKYKQYGGV--TERMI-----CAGFLEGGK 224
            |.|:|||:.:..:...||  |:.|.|||::...|...|.....|  .||::     |||:.:|.|
Human   160 CRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHK 224

  Fly   225 DACQGDSGGPMV---SESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            ||||||||||:.   |.|..||||||||.|||.|:.||||:.|:....||:
Human   225 DACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 89/238 (37%)
Tryp_SPc 51..274 CDD:238113 90/240 (38%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 89/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.