DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and TPSG1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:236 Identity:92/236 - (38%)
Similarity:128/236 - (54%) Gaps:13/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GRIVGGHRINITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCTYGK-TADRLKVRLGTSEFAR 111
            |||||||.......|.|.||:... |:||||::|.:|:||||||..|. .:...:|.||..|...
Human    61 GRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITL 125

  Fly   112 SGQLLRVQKIVQHAQ-FNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWG 175
            |.....|::|:.|:. ........|.:|::|:.|:........|.|||:...:..|..|:|:|||
Human   126 SPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWG 190

  Fly   176 NTQ--NLLESREWLRQVEVPLVNQELCSEKYKQYGG--VTERMICAGFLEGGKDACQGDSGGPMV 236
            .|:  ..|.....||:|:|.:|:.|.|...|...||  :...|:||   .|..||||.|||||:|
Human   191 YTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCA---RGPGDACQDDSGGPLV 252

  Fly   237 SE-SGELV--GVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            .: :|..|  |.||||.||.:|:.||||:||....:||:.|
Human   253 CQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 88/230 (38%)
Tryp_SPc 51..274 CDD:238113 89/232 (38%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 88/230 (38%)
Tryp_SPc 63..293 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.