DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK5

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:232 Identity:77/232 - (33%)
Similarity:124/232 - (53%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVS--LQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLG---TSEF 109
            ||:.|...::...|.|.:  |:.:...||..::..:|:||||||    .....:||||   .|..
Human    66 RIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHC----RKKVFRVRLGHYSLSPV 126

  Fly   110 ARSG-QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG 173
            ..|| |:.:..|.:.|..:::.....|..|::|...|:  .||....:..|......|..|.|||
Human   127 YESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIR--PTKDVRPINVSSHCPSAGTKCLVSG 189

  Fly   174 WGNTQN-LLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            ||.|:: .:...:.|:.:.:.:::|:.|.:.|.:.  :.:.|.|||. :.|:|:||||||||:|.
Human   190 WGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQ--IDDTMFCAGD-KAGRDSCQGDSGGPVVC 251

  Fly   238 ESGELVGVVSWG-YGCAKPDYPGVYSRVSFARDWIKE 273
             :|.|.|:|||| |.||:|:.||||:.:.....||:|
Human   252 -NGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 74/228 (32%)
Tryp_SPc 51..274 CDD:238113 76/231 (33%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 1/1 (100%)
Tryp_SPc 66..285 CDD:214473 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.