DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:266 Identity:104/266 - (39%)
Similarity:153/266 - (57%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLLVLAGV-CLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSSHICG 76
            :||:||.| ..:..|      |||            |.:||||:.......|:||||.:..|.||
  Rat     3 ALLILALVGAAVAFP------LED------------DDKIVGGYTCPEHSVPYQVSLNSGYHFCG 49

  Fly    77 GSIISEEWILTAAHCTYGKTADRLKVRLG---TSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSL 138
            ||:|:::|:::||||    ...|::||||   .:......|.:...||::|..::...::.|..|
  Rat    50 GSLINDQWVVSAAHC----YKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIML 110

  Fly   139 LQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNT-QNLLESREWLRQVEVPLVNQELCSE 202
            ::|:.|:|.:.....|.||.:...  .|..|.:|||||| .|.:.:.:.|:.|:.|:::|..|..
  Rat   111 IKLSSPVKLNARVAPVALPSACAP--AGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEA 173

  Fly   203 KYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFA 267
            .|.  |.:|..|||.||||||||:||||||||:|. :|:|.|:||||||||.||.||||::|...
  Rat   174 AYP--GEITSSMICVGFLEGGKDSCQGDSGGPVVC-NGQLQGIVSWGYGCALPDNPGVYTKVCNF 235

  Fly   268 RDWIKE 273
            ..||::
  Rat   236 VGWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 92/224 (41%)
Tryp_SPc 51..274 CDD:238113 94/227 (41%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 92/224 (41%)
Tryp_SPc 24..242 CDD:238113 94/227 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.