DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and TPSD1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:252 Identity:85/252 - (33%)
Similarity:120/252 - (47%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALRLFVLLQCSLLVLAGVCLI-PQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPH 64
            :||.::..||..:|.|||....: |.|   .::|:..             .||||.....:..|.
Human     3 LLAPQMLSLLLLALPVLASPAYVAPAP---GQALQQT-------------GIVGGQEAPRSKWPW 51

  Fly    65 QVSLQTSS----HICGGSIISEEWILTAAHCTYGKTAD--RLKVRLGTSEFARSGQLLRVQKIVQ 123
            ||||:...    |.||||:|..:|:||||||......|  .|:|:|.........|||.|.:|:.
Human    52 QVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIV 116

  Fly   124 HAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQN--LLESREW 186
            |.||.......|.:||:|..|:........|.||.:...:..|..|:|:|||:..|  .|.....
Human   117 HPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYP 181

  Fly   187 LRQVEVPLVNQELCSEKY-------KQYGGVTERMICAGFLEGGKDACQGDSGGPMV 236
            |::||||:|...||:.:|       ..:..|.:.|:|||  ....|:||||||||:|
Human   182 LKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAG--SENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 74/202 (37%)
Tryp_SPc 51..274 CDD:238113 74/201 (37%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 74/201 (37%)
Tryp_SPc 38..240 CDD:214473 74/201 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.