DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prss58

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:219 Identity:65/219 - (29%)
Similarity:108/219 - (49%) Gaps:13/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA----RSGQLLRVQK 120
            |..|:.|.|::....|.|.:|...|::|||||    ....|:|.||.:..|    |..::...:|
Mouse    26 TTPPYLVYLKSDYLPCTGVLIHPLWVITAAHC----NLPNLQVILGITNPADPMERDVEVSDYEK 86

  Fly   121 IVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWG-NTQNLLESR 184
            |..|..|..:::.:|..|::|...||.....||||||:..:..  ...|.||.|. |..::.:..
Mouse    87 IFHHPNFLVSSISHDLLLIKLKRRIKHSNYAKAVKLPQHIVSV--NAMCSVSTWAYNLCDVTKDP 149

  Fly   185 EWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWG 249
            :.|:.|.|.::::..|...||.: .:||.|||.|.:.|.:..|:..:..|.|. :|.|.|::|:.
Mouse   150 DSLQTVNVTVISKAECRNAYKAF-DITENMICVGIVPGRRLPCKEVTAAPAVC-NGVLYGILSYA 212

  Fly   250 YGCAKPDYPGVYSRVSFARDWIKE 273
            .||......|:|:.:.....||::
Mouse   213 DGCVLRADVGIYASIFHYLPWIED 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 63/215 (29%)
Tryp_SPc 51..274 CDD:238113 65/219 (30%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 64/216 (30%)
Tryp_SPc 29..234 CDD:214473 62/212 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.