DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and F9

DIOPT Version :10

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:240 Identity:86/240 - (35%)
Similarity:127/240 - (52%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTS-SHICGGSIISEEWILTAAHCTYGKTADRLKVRLG---TSEFA 110
            |:|||........|.||.|... ...|||||::|:||:|||||.  :|..::.|..|   ..|..
Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCV--ETGVKITVVAGEHNIEETE 288

  Fly   111 RSGQLLRVQKIVQHAQFN--YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQ-----MKYMDGEA 168
            .:.|...|.:|:.|..:|  ....::|.:||:|..|:..:.....:.:.:.:     :|:..|  
Human   289 HTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSG-- 351

  Fly   169 CFVSGWGNTQNLLESREWLRQVEVPLVNQELC--SEKYKQYGGVTERMICAGFLEGGKDACQGDS 231
             :|||||...:...|...|:.:.||||::..|  |.|:..|    ..|.||||.|||:|:|||||
Human   352 -YVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIY----NNMFCAGFHEGGRDSCQGDS 411

  Fly   232 GGPMVSE---SGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            |||.|:|   :..|.|::|||..||.....|:|::||...:||||
Human   412 GGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 85/239 (36%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:464251
Tryp_SPc 227..457 CDD:238113 85/239 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.