DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Prtn3

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:231 Identity:72/231 - (31%)
Similarity:100/231 - (43%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTS----SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA 110
            :|||||.......|:..|||.|    ||.|||::|...::||||||....:...:.|.||..:..
Mouse    29 KIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLL 93

  Fly   111 RSGQLLRVQKIVQHAQFNYT---NVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVS 172
            .|....:...|.|..|.||.   |:: |..||||.......:......||:.......|..|...
Mouse    94 SSEPEQQKFTISQVFQNNYNPEENLN-DVLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAM 157

  Fly   173 GWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            |||.......:...|:::.|.:|. .||          .|..:|..........|.||||||::.
Mouse   158 GWGRLGTQAPTPRVLQELNVTVVT-FLC----------REHNVCTLVPRRAAGICFGDSGGPLIC 211

  Fly   238 ESGELVGVVSWGY-GCAKPDYPGVYSRVSFARDWIK 272
             :|.|.||.|:.. .||...:|..::|||...|||:
Mouse   212 -NGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 70/228 (31%)
Tryp_SPc 51..274 CDD:238113 72/230 (31%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 70/228 (31%)
Tryp_SPc 30..248 CDD:238113 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.