DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and try-1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:241 Identity:90/241 - (37%)
Similarity:127/241 - (52%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDGRIVGGHRINITDAPH------QVSLQTSSHICGGSIISEEWILTAAHCTYGKTADR----LK 101
            ||.|::||..    .:||      |:..:...|.||||:|...::|||||| :.|  ||    ..
 Worm    54 LDHRLIGGSE----SSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHC-FAK--DRRPTSYS 111

  Fly   102 VRLGTSEFARSGQLLRVQKIVQHAQFNY-TNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMD 165
            ||:| ...:.||...||..:..|..:|. ....|||:::::..|:....|.:.:.||  .:..::
 Worm   112 VRVG-GHRSGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLP--SLPAVE 173

  Fly   166 GEACFVSGWGNT-QNLLESREWLRQVEVPLVNQELCSEKYKQYGGV-TERMICAGFLEGGKDACQ 228
            ...|.|:|||:| :....|...||::.|||::...||......|.: ...|:|||:..|..|:||
 Worm   174 NRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQ 238

  Fly   229 GDSGGP-MVSESG--ELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            |||||| |.:..|  ||.||||||.|||:|..||||..|..|..||
 Worm   239 GDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 86/236 (36%)
Tryp_SPc 51..274 CDD:238113 87/237 (37%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 87/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.