DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Tpsb2

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:293 Identity:104/293 - (35%)
Similarity:149/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ 69
            ||.:||....|:.:.|...|:|..::..                  |||||..:.:..|.||||:
Mouse     4 RLLLLLWALSLLASLVYSAPRPANQRVG------------------IVGGHEASESKWPWQVSLR 50

  Fly    70 TS----SHICGGSIISEEWILTAAHCT--YGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFN 128
            ..    .|.||||:|..:|:||||||.  :.|:....:|:|.........|||.:.:||.|..:.
Mouse    51 FKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYY 115

  Fly   129 YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQN--LLESREWLRQVE 191
            ......|.:||:|..|:........:.||.:...:..|.:|:|:|||:..|  .|.....|:||:
Mouse   116 TAEGGADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVK 180

  Fly   192 VPLVNQELCSEKYKQ--YGG-----VTERMICAGFLEGGKDACQGDSGGPMVSE-SGELV--GVV 246
            ||:|...||..||..  |.|     |.:.|:|||  ...:|:||||||||:|.: .|..:  |||
Mouse   181 VPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAG--NTRRDSCQGDSGGPLVCKVKGTWLQAGVV 243

  Fly   247 SWGYGCAKPDYPGVYSRVSFARDWI----KEHS 275
            |||.|||:|:.||:|:||::..|||    .|||
Mouse   244 SWGEGCAQPNKPGIYTRVTYYLDWIHRYVPEHS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/238 (38%)
Tryp_SPc 51..274 CDD:238113 93/244 (38%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 93/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.