DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk1b16

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_032480.1 Gene:Klk1b16 / 16615 MGIID:891982 Length:261 Species:Mus musculus


Alignment Length:249 Identity:83/249 - (33%)
Similarity:122/249 - (48%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPRLDGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTS 107
            :|.:..|||||.:......|.||:: ....|||||.::...|:||||||    ..|..:|.||.:
Mouse    18 APPVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWVLTAAHC----YVDECEVWLGKN 78

  Fly   108 EFAR---SGQLLRVQKIVQHAQFNYTNVDY-------DFS----LLQLAHPIKFDETKKAVKLPE 158
            :..:   |.|...|.|...|..||.|.:.:       |||    ||:|:.|....:..|.:.||.
Mouse    79 QLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSNDLMLLRLSKPADITDVVKPIDLPT 143

  Fly   159 SQMKYMDGEACFVSGWGN-TQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEG 222
            .:.| :| ..|.|||||: |....:..:.|:.:...|:..|.|::.|..  .||:.|:|.  :|.
Mouse   144 KEPK-LD-STCLVSGWGSITPTKWQKPDDLQCMFTKLLPNENCAKAYLL--KVTDVMLCT--IEM 202

  Fly   223 GKD--ACQGDSGGPMVSESGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWIKE 273
            |:|  .|.||||||::.: |.|.|.||.|.. |..|....:|:.:.....|||:
Mouse   203 GEDKGPCVGDSGGPLICD-GVLQGTVSIGPDPCGIPGVSAIYTNLVKFNSWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 79/239 (33%)
Tryp_SPc 51..274 CDD:238113 81/242 (33%)
Klk1b16NP_032480.1 Tryp_SPc 25..256 CDD:238113 81/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.