DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Gzmk

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:232 Identity:74/232 - (31%)
Similarity:126/232 - (54%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHC-TYGKTADRLKVRLGTSEFARS- 112
            |:||..:.....|...|:| .|.|||||.:|..:|:|||||| ::........|.||....::: 
Mouse    26 IIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNE 90

  Fly   113 --GQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYM-DGEACFVSGW 174
              .|...::|.:..::....:..:|..|::|....:.::..:.:.|  ....|: ||..|.|:||
Mouse    91 PMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHL--GSKNYLRDGTKCQVTGW 153

  Fly   175 GNTQ-NLLESREWLRQVEVPLVNQELCSEK--YKQYGGVTERMICAGFLEGGKDACQGDSGGPMV 236
            |.|: :||.:.:.||:|.|.:::::.|:.:  |.....:|:.|||||...|.||:|:||||||::
Mouse   154 GTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLI 218

  Fly   237 SESGELVGVVSWGYGCAKPDYPGVYSRVSFA-RDWIK 272
            .: |....:||.||.|.....||:|:.::.. :.|||
Mouse   219 CK-GIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 71/229 (31%)
Tryp_SPc 51..274 CDD:238113 74/232 (32%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 71/229 (31%)
Tryp_SPc 26..256 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.