DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Gzme

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_034503.2 Gene:Gzme / 14942 MGIID:109265 Length:248 Species:Mus musculus


Alignment Length:237 Identity:67/237 - (28%)
Similarity:118/237 - (49%) Gaps:26/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IVGGHRINITDAPH-----QVSLQTSSHICGGSIISEEWILTAAHC-------TYGKTADRLKVR 103
            |:|||.:.....|:     .|.::.:...|||.::.::::||||||       |.|  |..:|.:
Mouse    21 IIGGHVVKPHSRPYMAFVKSVDIEGNRRYCGGFLVQDDFVLTAAHCRNRTMTVTLG--AHNIKAK 83

  Fly   104 LGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
            ..|.      |::.|.|.:.|..:|.|....|..||:|....|..:..:.:|||....:...|:.
Mouse    84 EETQ------QIIPVAKAIPHPDYNATAFFSDIMLLKLESKAKRTKAVRPLKLPRPNARVKPGDV 142

  Fly   169 CFVSGWGNTQ-NLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSG 232
            |.|:|||:.. |..::...||:.::.:...|.|.::::.|...||  ||||.|:..|...:||||
Mouse   143 CSVAGWGSRSINDTKASARLREAQLVIQEDEECKKRFRHYTETTE--ICAGDLKKIKTPFKGDSG 205

  Fly   233 GPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            ||:|.:: :..|:::  |...:....||::::.....||..:
Mouse   206 GPLVCDN-KAYGLLA--YAKNRTISSGVFTKIVHFLPWISRN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 65/232 (28%)
Tryp_SPc 51..274 CDD:238113 67/235 (29%)
GzmeNP_034503.2 Tryp_SPc 20..241 CDD:214473 65/232 (28%)
Tryp_SPc 21..244 CDD:238113 67/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.