DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Gzma

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:231 Identity:77/231 - (33%)
Similarity:123/231 - (53%) Gaps:11/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTSSH-ICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR-- 111
            ||:||..:.....|:...|:.||: ||.|::|.:.|:||||||..||   |.|..||.....:  
Mouse    28 RIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGK---RSKFILGAHSINKEP 89

  Fly   112 SGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGN 176
            ..|:|.|:|...:..::....:.|..|::|......:.....:.||:.......|..|.|:|||.
Mouse    90 EQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGR 154

  Fly   177 TQNLLESREWLRQVEVPLVNQELCSEK--YKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSES 239
            ..|.....|.||:|.:.::::::|:::  |..:..:...|||||.|.||||:|.||||.|::.: 
Mouse   155 FGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCD- 218

  Fly   240 GELVGVVSW-GYGCAKPDYPGVYSRVSFAR-DWIKE 273
            |.|.|:.|: |..|....:||||:.:|... :|||:
Mouse   219 GILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 74/227 (33%)
Tryp_SPc 51..274 CDD:238113 76/230 (33%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 74/227 (33%)
Tryp_SPc 29..255 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.