DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS36

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:286 Identity:99/286 - (34%)
Similarity:143/286 - (50%) Gaps:29/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLAGVCLIPQPVK---RQRSLEDVIKNPWKLS---PRLDGRIVGGHRINITDAPHQVSL-QTSS 72
            |:|..|.|:..|:.   :..:|....:.|..|.   |....|||||........|.|||| ....
Human     5 LLLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGG 69

  Fly    73 HICGGSIISEEWILTAAHC--TYG--KTADRLKVRLGTSEFARSGQL-----LRVQKIVQHAQFN 128
            ||||||:|:..|:|:||||  |.|  :.|....|.||.  .::.|.|     ..|..||..|.::
Human    70 HICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGV--HSQDGPLDGAHTRAVAAIVVPANYS 132

  Fly   129 YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNL--LESREWLRQVE 191
            ...:..|.:||:||.|.........|.||.:..:::.|.||:.:|||:.|..  |.....|::||
Human   133 QVELGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVE 197

  Fly   192 VPLVNQELCSEKYKQYG------GVTERMICAGFLEGGKDACQGDSGGPMVSESGE---LVGVVS 247
            :.|:.:..|...|.|.|      .:...|:|||:.||.:|.||||||||:|.|.|.   ..|:.|
Human   198 LRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITS 262

  Fly   248 WGYGCAKPDYPGVYSRVSFARDWIKE 273
            :|:||.:.:.|||::.|:....||:|
Human   263 FGFGCGRRNRPGVFTAVATYEAWIRE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 87/241 (36%)
Tryp_SPc 51..274 CDD:238113 89/244 (36%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 87/241 (36%)
Tryp_SPc 47..289 CDD:238113 89/244 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.