DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and PRSS37

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005250003.1 Gene:PRSS37 / 136242 HGNCID:29211 Length:265 Species:Homo sapiens


Alignment Length:260 Identity:62/260 - (23%)
Similarity:100/260 - (38%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 APHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT-SEFARSG--QLLRVQKIVQ 123
            ||:.|.|::..:.|.|.:|...|:|..|||    ....|||.||. ....|.|  |.:...:||:
Human    27 APYLVYLKSHFNPCVGVLIKPSWVLAPAHC----YLPNLKVMLGNFKSRVRDGTEQTINPIQIVR 87

  Fly   124 HAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG--WGNTQNLLESRE- 185
            :..::::....|..|::||.|...:...:.:.|..:.::  .|..|.:||  |....:.|...| 
Human    88 YWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTLATTNVR--PGTVCLLSGLDWSQENSGLWQLEP 150

  Fly   186 --------------W-------------LRQ-VEVPLVNQELCSEKYKQYGGVTERMICAGFLE- 221
                          |             ||| :|.|:::...| :|.:| |......:|..|:: 
Human   151 PGHLTLHRGPAIPDWQRHNSHEQGRHPDLRQNLEAPVMSDREC-QKTEQ-GKSHRNSLCVKFVKV 213

  Fly   222 -----GG--------KDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
                 |.        ||..||...|..:   |..||:           |..||..||:..:..|:
Human   214 FSRIFGEVAVATVICKDKLQGIEVGHFM---GGDVGI-----------YTNVYKYVSWIENTAKD 264

  Fly   274  273
            Human   265  264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 61/256 (24%)
Tryp_SPc 51..274 CDD:238113 62/260 (24%)
PRSS37XP_005250003.1 Tryp_SPc 28..261 CDD:304450 60/254 (24%)
Tryp_SPc 28..258 CDD:214473 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.