Sequence 1: | NP_722915.1 | Gene: | CG31954 / 33572 | FlyBaseID: | FBgn0051954 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005250003.1 | Gene: | PRSS37 / 136242 | HGNCID: | 29211 | Length: | 265 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 62/260 - (23%) |
---|---|---|---|
Similarity: | 100/260 - (38%) | Gaps: | 70/260 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 APHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT-SEFARSG--QLLRVQKIVQ 123
Fly 124 HAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG--WGNTQNLLESRE- 185
Fly 186 --------------W-------------LRQ-VEVPLVNQELCSEKYKQYGGVTERMICAGFLE- 221
Fly 222 -----GG--------KDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
Fly 274 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31954 | NP_722915.1 | Tryp_SPc | 50..271 | CDD:214473 | 61/256 (24%) |
Tryp_SPc | 51..274 | CDD:238113 | 62/260 (24%) | ||
PRSS37 | XP_005250003.1 | Tryp_SPc | 28..261 | CDD:304450 | 60/254 (24%) |
Tryp_SPc | 28..258 | CDD:214473 | 60/251 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |