DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and CTRC

DIOPT Version :10

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:94 Identity:17/94 - (18%)
Similarity:37/94 - (39%) Gaps:24/94 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 IYSHHLKSKMKRQTIIKTARDLRLTGFSRPGK-PAIICVEGQQADTQEF------WRTIKPLKWQ 230
            :::.|:|.:.:.:.:.|.|..|   |...||: ..::..:|...:..:|      ||..|..:..
Human   176 LFAKHIKVQEQVKLLEKRAIHL---GVGTPGRIKELVKQDGLNLNPLKFLVFDWNWRDQKLRRMM 237

  Fly   231 KIQ--------------IKLCETETVAAG 245
            .|.              ..||:::::..|
Human   238 DIPEIRKEVFELLDMGVFSLCKSDSLKLG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113 17/94 (18%)
CTRCXP_011538852.1 Tryp_SPc 30..>173 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.