DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK8

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:263 Identity:86/263 - (32%)
Similarity:125/263 - (47%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWIL 86
            :|......|:.||              :::|||.......|.|.:| |....:|||.::...|:|
Human    64 LPPAAGHSRAQED--------------KVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVL 114

  Fly    87 TAAHCTYGKTADRLKVRLGTSEFARSG---QLLRVQKIVQHAQFNYTNVD---YDFSLLQLAHPI 145
            |||||...|    ..||||........   |.:.|.:.:.|..:|.::|:   :|..||||....
Human   115 TAAHCKKPK----YTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQA 175

  Fly   146 KFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLES-REWLRQVEVPLVNQELCSEKYKQYGG 209
            ......|.:.|.:...:  .|:.|.|||||...:..|: .:.|...||.:..|:.|.:.|.  |.
Human   176 SLGSKVKPISLADHCTQ--PGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYP--GQ 236

  Fly   210 VTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWIKE 273
            :|:.|:|||..:|. |.||||||||:|.: |.|.|:.|||.. |.:.|.||||:.:....||||:
Human   237 ITDGMVCAGSSKGA-DTCQGDSGGPLVCD-GALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKK 299

  Fly   274 HSG 276
            ..|
Human   300 IIG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 78/229 (34%)
Tryp_SPc 51..274 CDD:238113 81/231 (35%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 78/229 (34%)
Tryp_SPc 78..300 CDD:238113 81/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.