DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and KLK11

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:282 Identity:85/282 - (30%)
Similarity:129/282 - (45%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVKRQRSLEDVIKNPWKLSPRLDG---RIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWIL 86
            |::..|.|:.::   ..|:..|.|   ||:.|........|.|.:| :.:..:||.::|:..|:|
Human    29 PLQAMRILQLIL---LALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLL 90

  Fly    87 TAAHCTYGKTA---------------------DRLKVRLGTSEFARS---GQLLRVQKIVQHAQF 127
            |||||.....:                     .|..|.||.....:.   .|.....:...|..|
Human    91 TAAHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPGF 155

  Fly   128 NYT--NVDY--DFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQN-LLESREWL 187
            |.:  |.|:  |..|:::|.|:......:.:.|  |......|.:|.:||||:|.: .|.....|
Human   156 NNSLPNKDHRNDIMLVKMASPVSITWAVRPLTL--SSRCVTAGTSCLISGWGSTSSPQLRLPHTL 218

  Fly   188 RQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYG- 251
            |...:.::..:.|...|.  |.:|:.|:||...|||||:||||||||:|... .|.|::|||.. 
Human   219 RCANITIIEHQKCENAYP--GNITDTMVCASVQEGGKDSCQGDSGGPLVCNQ-SLQGIISWGQDP 280

  Fly   252 CAKPDYPGVYSRVSFARDWIKE 273
            ||....||||::|....|||:|
Human   281 CAITRKPGVYTKVCKYVDWIQE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 76/251 (30%)
Tryp_SPc 51..274 CDD:238113 78/254 (31%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 76/251 (30%)
Tryp_SPc 54..303 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.