DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and LOC105945797

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:235 Identity:95/235 - (40%)
Similarity:138/235 - (58%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF-AR 111
            |.:||||:.......|:.|||....|.||||:||.:|:::||||...|    ::||||..:. |.
 Frog    18 DDKIVGGYTCAPNSVPYIVSLNAGYHFCGGSLISSQWVVSAAHCFMNK----IEVRLGEHDIKAT 78

  Fly   112 SG--QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGW 174
            .|  |.:...|::::..::...:|.|..|::||.|...::....|.||...::  ....|.:|||
 Frog    79 EGTEQFINSAKVIKNKGYSPRTLDNDIMLIKLATPAILNQYVSPVPLPSGCIE--PRANCLISGW 141

  Fly   175 GNT-------QNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSG 232
            |||       .|||:.      |..|::..:.|::.|.  |.:|:.|||.||||||||:||||||
 Frog   142 GNTLSSGSNYPNLLQC------VSAPVLTADECNKAYP--GEITQNMICVGFLEGGKDSCQGDSG 198

  Fly   233 GPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272
            ||:|. :|||.|:||||||||:.:|||||::|.....||:
 Frog   199 GPVVC-NGELQGIVSWGYGCAEKNYPGVYTKVCNYNAWIE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 92/230 (40%)
Tryp_SPc 51..274 CDD:238113 94/232 (41%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 94/232 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.