DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and LOC103908930

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:226 Identity:88/226 - (38%)
Similarity:128/226 - (56%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF---A 110
            :|:||:.......|.|:.: ......||.|:|:|.|.::||||..|  |:.|.|.||....   .
Zfish    20 KIIGGYECPPNSQPWQIYITNDGQRWCGASLINESWAVSAAHCNIG--ANLLTVYLGKHNIDVVE 82

  Fly   111 RSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWG 175
            ::.|.:|.:|:..|.:|.:.:.|.|..|::|..|..|::..:.:.|..|...  :||.|.|||||
Zfish    83 KTEQRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQYVQPIPLATSCSS--EGEQCLVSGWG 145

  Fly   176 NTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESG 240
            .|:..|.|  .|:.:::.:.:::.|...||.  ..|:.|:||||:||||..|.||||||:|. :|
Zfish   146 YTEVGLPS--VLQCLDLAVQSRQECERVYKD--KFTQNMLCAGFMEGGKGVCHGDSGGPLVC-NG 205

  Fly   241 ELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            ||.||||||.|||:|.||.||..|....|||
Zfish   206 ELRGVVSWGAGCAEPGYPAVYVEVCRYSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 86/224 (38%)
Tryp_SPc 51..274 CDD:238113 88/225 (39%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3890
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.