DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Klk9

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:235 Identity:80/235 - (34%)
Similarity:121/235 - (51%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR 111
            |.|.||.........|.|..| ..:..:||.::|:::|:||||||    ....|.||||.....|
Mouse    20 DTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC----RKPYLWVRLGEHHLWR 80

  Fly   112 ---SGQLLRVQKIVQHAQFN----YTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEAC 169
               ..|||.|.....|..||    ..:.:.|..|::|...::.....:.:.|.||:...  |..|
Mouse    81 WEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLTPAVQPLNLTESRPPV--GTQC 143

  Fly   170 FVSGWGN-TQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGG 233
            .:||||: :.:.|:....|:...:.:::.:||...|.  |.::|:|:|||..|||:.:|||||||
Mouse   144 LISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYP--GHISEKMLCAGLWEGGRGSCQGDSGG 206

  Fly   234 PMVSESGELVGVVSWG-YGCAKPDYPGVYSRVSFARDWIK 272
            |:|.| |.|.|:||.| ..|::|..|.||:.|....:||:
Mouse   207 PLVCE-GTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 77/230 (33%)
Tryp_SPc 51..274 CDD:238113 78/232 (34%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.