DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and prss59.2

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:235 Identity:95/235 - (40%)
Similarity:136/235 - (57%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRL-------- 104
            |.:||||:.......|.|.||.:..|.||||::||.|:::||||    ...||:|||        
Zfish    18 DDKIVGGYECQPNSQPWQASLNSGYHFCGGSLVSEYWVVSAAHC----YKSRLEVRLGEHNIVIN 78

  Fly   105 -GTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEA 168
             ||.:|..|      :|::::..::...:|.|..|::|:.|...::..:.|.||....  .||..
Zfish    79 EGTEQFITS------EKVIRNPNYDSWTIDSDIMLIKLSKPATLNKYVQPVALPNGCA--ADGTM 135

  Fly   169 CFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGG 233
            |.|||||||.:.......|:.:|:|:::...|...|.  |.:|:.|.|||:||||||:|||||||
Zfish   136 CRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSYP--GMITDTMFCAGYLEGGKDSCQGDSGG 198

  Fly   234 PMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273
            |:|. :|||.|:||||||||:.|.||||.:|.....||.:
Zfish   199 PVVC-NGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIAD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 92/229 (40%)
Tryp_SPc 51..274 CDD:238113 94/232 (41%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 92/229 (40%)
Tryp_SPc 21..238 CDD:238113 94/232 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3890
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.