DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and Tpsab1

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:293 Identity:102/293 - (34%)
Similarity:145/293 - (49%) Gaps:44/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALRLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQ 65
            ||.|.|..|...|.||.|.    |.|...:..                  ||||...:....|.|
Mouse     1 MLKLLLLTLPLLSSLVHAA----PGPAMTREG------------------IVGGQEAHGNKWPWQ 43

  Fly    66 VSLQTSS----HICGGSIISEEWILTAAHCTYGKTAD--RLKVRLGTSEFARSGQLLRVQKIVQH 124
            |||:.:.    |.||||:|..:|:||||||.....||  :::|:|..........|:.|.:|:.|
Mouse    44 VSLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKVRVQLRKQYLYYHDHLMTVSQIITH 108

  Fly   125 AQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQN--LLESREWL 187
            ..|.......|.:||:|.:|:...:....|.||.:...:..|..|:|:||||..|  .|.....|
Mouse   109 PDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCWVTGWGNIDNGVNLPPPFPL 173

  Fly   188 RQVEVPLVNQELCSEKYKQYGGVT--------ERMICAGFLEGGKDACQGDSGGPMVSESGEL-- 242
            ::|:||::...||..||.: |.:|        :.|:|||  ..|.|:||||||||:|.:..:.  
Mouse   174 KEVQVPIIENHLCDLKYHK-GLITGDNVHIVRDDMLCAG--NEGHDSCQGDSGGPLVCKVEDTWL 235

  Fly   243 -VGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
             .||||||.|||:|:.||:|:||::..|||..:
Mouse   236 QAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 89/239 (37%)
Tryp_SPc 51..274 CDD:238113 91/241 (38%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 90/239 (38%)
Tryp_SPc 29..265 CDD:214473 89/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.