DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and LOC100498532

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:231 Identity:84/231 - (36%)
Similarity:127/231 - (54%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFAR 111
            |.:||||:.......|.||.. ....:.||||:||..||::||||.  :....|...||..:..:
 Frog    22 DDKIVGGYECTPHSQPWQVLFTYNGGNWCGGSLISPRWIISAAHCY--QPPKTLVALLGEHDLKK 84

  Fly   112 ---SGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSG 173
               :.|.::|:...:|..:.....|:|..|::||.|.::::..:.:  |.::....||..|.|||
 Frog    85 KEGTEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYNQYVQPI--PVARSCPTDGAKCLVSG 147

  Fly   174 WGNTQNL-LESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            :||.... :...:.|:.:|||:|:...|...|.:.  ::|.|.|||||||||.:|.||||||::.
 Frog   148 FGNVLGYNVRYPDQLQCLEVPIVSDSSCKASYPRM--ISENMFCAGFLEGGKGSCHGDSGGPLIC 210

  Fly   238 ESGELVGVVSWGYG-CAKPDYPGVYSRVSFARDWIK 272
             :|||.|.||||.. |...:.||||::|....||||
 Frog   211 -NGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 80/226 (35%)
Tryp_SPc 51..274 CDD:238113 83/228 (36%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 83/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm9407
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.