DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and zgc:171509

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:225 Identity:84/225 - (37%)
Similarity:130/225 - (57%) Gaps:14/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF---AR 111
            :|:|||.......|.|..|.....:||||:|.|.|:::||||    .:..:.|.||..:.   ..
Zfish    20 KIIGGHECQPHSQPWQARLDDGYGLCGGSLIHESWVVSAAHC----KSSSIIVHLGKHDLFVVED 80

  Fly   112 SGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGN 176
            :.|.::.:|::.|.::|....:.|..|::|..|...:...|.|.||.:...  .||.|.|||||.
Zfish    81 TAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSH--AGEQCLVSGWGV 143

  Fly   177 TQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGE 241
            |.:.:.|.  |:.:|:|::::..|...|.:.  :|::|.||||::||||:||||||||:|. :|.
Zfish   144 TGDSISST--LQCLELPILSKADCKSAYGRV--ITKKMFCAGFMDGGKDSCQGDSGGPVVC-NGT 203

  Fly   242 LVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271
            |.|:||:|.|||:|.:||||..|....:||
Zfish   204 LKGIVSFGIGCAEPGFPGVYVEVCRYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/223 (37%)
Tryp_SPc 51..274 CDD:238113 84/224 (38%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 82/223 (37%)
Tryp_SPc 21..234 CDD:238113 84/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3890
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.