DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and zgc:165423

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:246 Identity:92/246 - (37%)
Similarity:141/246 - (57%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDGRIVGGHRINITDAPHQVSL-QTSSHICGGSIISEEWILTAAHC-----------TY-GKTAD 98
            |:.:||||...:....|.|.|| ::.||.||||:||::|||:||||           .| |:.:.
Zfish    34 LNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPSDYTVYLGRQSQ 98

  Fly    99 RLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKY 163
            .|.   ..:|.::|     |.:::.|..:..:..|.|.:||.|:.|:.|....:.|.|......:
Zfish    99 DLP---NPNEVSKS-----VSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLAADGSTF 155

  Fly   164 MDGEACFVSGWGNTQN--LLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDA 226
            .: :..:::|||..::  .|.|.:.|::|.||:|...||:..|.....:|..|:|||.::||||:
Zfish   156 YN-DTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDS 219

  Fly   227 CQGDSGGPMVSESGEL---VGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274
            ||||||||||.:|...   .||||:|.|||.|:|||||:|||..::||.::
Zfish   220 CQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 89/238 (37%)
Tryp_SPc 51..274 CDD:238113 91/240 (38%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 89/238 (37%)
Tryp_SPc 38..269 CDD:238113 91/239 (38%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.