DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31954 and gzm3.4

DIOPT Version :9

Sequence 1:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:234 Identity:75/234 - (32%)
Similarity:120/234 - (51%) Gaps:11/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LDGRIVGGHRINITDAPHQVSLQTS-SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGT---S 107
            ::..||||..:.:...|:..|||.. .|.|||.:|.|:::||:|||  .|....|:|.||.   |
Zfish    21 MESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTSAHC--WKDTTNLEVVLGAHNIS 83

  Fly   108 EFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVS 172
            :...|.|:::|||.::|..:...|..:|..||:|......:.......||:.:...:....|.::
Zfish    84 QRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHFVNITNLPKHEPSILAPVECSIA 148

  Fly   173 GWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVS 237
            |||..:....:...||:|.:.|.:...|..|::.|.. ::.|:|.. .:|.|..||||||.|:..
Zfish   149 GWGMQRPGEGASNVLREVNLQLESNSYCKSKWQVYFN-SKNMVCTA-SDGKKAFCQGDSGSPLFC 211

  Fly   238 ESGELVGVVSWGY--GCAKPDYPGVYSRVSFARDWIKEH 274
            .| ||.|:.::.|  .|...:||.||.:||....|||::
Zfish   212 NS-ELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWIKKN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 72/226 (32%)
Tryp_SPc 51..274 CDD:238113 75/228 (33%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 75/228 (33%)
Tryp_SPc 25..246 CDD:214473 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.