Sequence 1: | NP_001285588.1 | Gene: | Thor / 33569 | FlyBaseID: | FBgn0261560 | Length: | 117 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003723.1 | Gene: | EIF4EBP3 / 8637 | HGNCID: | 3290 | Length: | 100 | Species: | Homo sapiens |
Alignment Length: | 90 | Identity: | 40/90 - (44%) |
---|---|---|---|
Similarity: | 58/90 - (64%) | Gaps: | 5/90 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 QMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRT-PFRKCV 92
Fly 93 PVPTELIKQTKSLKIEDQEQFQLDL 117 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Thor | NP_001285588.1 | eIF_4EBP | 3..117 | CDD:398880 | 39/88 (44%) |
EIF4EBP3 | NP_003723.1 | eIF_4EBP | 5..100 | CDD:310216 | 39/88 (44%) |
YXXXXLphi motif. /evidence=ECO:0000269|PubMed:9593750 | 40..46 | 3/5 (60%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..100 | 6/18 (33%) | |||
TOS motif. /evidence=ECO:0000250|UniProtKB:Q13541 | 96..100 | 1/3 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148533 | |
Domainoid | 1 | 1.000 | 83 | 1.000 | Domainoid score | I8345 |
eggNOG | 1 | 0.900 | - | - | E1_2CQCV | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 85 | 1.000 | Inparanoid score | I5169 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1597535at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002674 | |
OrthoInspector | 1 | 1.000 | - | - | otm42193 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12669 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5872 |
SonicParanoid | 1 | 1.000 | - | - | X1786 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
13 | 12.890 |