DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and EIF4EBP3

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_003723.1 Gene:EIF4EBP3 / 8637 HGNCID:3290 Length:100 Species:Homo sapiens


Alignment Length:90 Identity:40/90 - (44%)
Similarity:58/90 - (64%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRT-PFRKCV 92
            |:|:.||:|||||||:||||||::||:|.|:...:.||:::|||..:|......||.| |..|. 
Human    15 QLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKL- 78

  Fly    93 PVPTELIKQTKSLKIEDQEQFQLDL 117
               .||.:|....:|.|..||::|:
Human    79 ---EELKEQETEEEIPDDAQFEMDI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 39/88 (44%)
EIF4EBP3NP_003723.1 eIF_4EBP 5..100 CDD:310216 39/88 (44%)
YXXXXLphi motif. /evidence=ECO:0000269|PubMed:9593750 40..46 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 6/18 (33%)
TOS motif. /evidence=ECO:0000250|UniProtKB:Q13541 96..100 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148533
Domainoid 1 1.000 83 1.000 Domainoid score I8345
eggNOG 1 0.900 - - E1_2CQCV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5169
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm42193
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5872
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.