DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and eif4ebp3

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001007355.1 Gene:eif4ebp3 / 492482 ZFINID:ZDB-GENE-041114-44 Length:104 Species:Danio rerio


Alignment Length:105 Identity:39/105 - (37%)
Similarity:62/105 - (59%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGSPLSQTPPSNVPSCLL 80
            |:.:|.:.......:|:.||.|||||::|||||||::||:|.|:...|.||:::|||..:|.  :
Zfish    11 PIPSRSIHEKSWSPLPDSYSQTPGGTVFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPD--I 73

  Fly    81 RGTPRTPFRKCVPVPTELIKQ---TKSLKIEDQEQFQLDL 117
            .|..|...        ::|:|   :|.|.|:| .||.:|:
Zfish    74 PGVTRPSL--------QIIEQEEDSKDLSIDD-SQFVIDI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 38/103 (37%)
eif4ebp3NP_001007355.1 eIF_4EBP 8..104 CDD:283183 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582450
Domainoid 1 1.000 81 1.000 Domainoid score I8429
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5190
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm25763
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12669
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.