DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and eif4ebp2

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_997968.1 Gene:eif4ebp2 / 386945 ZFINID:ZDB-GENE-031118-83 Length:113 Species:Danio rerio


Alignment Length:132 Identity:48/132 - (36%)
Similarity:77/132 - (58%) Gaps:34/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASPTARQ-AITQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRG 64
            ||:|   || :.::|:|  ||.|:|:|..|:|..|.:||||||:|||||||::||:|.|:.:.|.
Zfish     1 MSSS---RQLSESRAIP--TRTVLINDSTQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRN 60

  Fly    65 SPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPT-----ELIKQTKSLKIEDQE---------QFQL 115
            ||::||||:::|              .:|..|     ..||:.::..|.:.:         ||::
Zfish    61 SPIAQTPPAHLP--------------VIPGVTGKNILNEIKRNEANNINNHDAKPGQGEDAQFEM 111

  Fly   116 DL 117
            |:
Zfish   112 DI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 45/128 (35%)
eif4ebp2NP_997968.1 eIF_4EBP 9..113 CDD:283183 42/119 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582452
Domainoid 1 1.000 81 1.000 Domainoid score I8429
eggNOG 1 0.900 - - E1_2CQCV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5190
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm25763
orthoMCL 1 0.900 - - OOG6_105200
Panther 1 1.100 - - O PTHR12669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5872
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.