DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and Eif4ebp2

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001028241.1 Gene:Eif4ebp2 / 361845 RGDID:1310824 Length:120 Species:Rattus norvegicus


Alignment Length:131 Identity:48/131 - (36%)
Similarity:74/131 - (56%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASPTARQAITQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGS 65
            ||||.......:|:..:.||.|.|||..|:|:.|.:||||||:|||||||::||:|.|:.:.|.|
  Rat     1 MSASAGGGHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNS 65

  Fly    66 PLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIKQTK--------------SLKIEDQEQFQLD 116
            |::||||.::|:  :.|         |..|..|::.:|              ...:.|:.||::|
  Rat    66 PMAQTPPCHLPN--IPG---------VTSPGALMEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMD 119

  Fly   117 L 117
            :
  Rat   120 I 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 45/127 (35%)
Eif4ebp2NP_001028241.1 eIF_4EBP 3..120 CDD:398880 45/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342430
Domainoid 1 1.000 83 1.000 Domainoid score I8160
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5066
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm46342
orthoMCL 1 0.900 - - OOG6_105200
Panther 1 1.100 - - O PTHR12669
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.