DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and eif4ebp3l

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_955977.1 Gene:eif4ebp3l / 324490 ZFINID:ZDB-GENE-030826-26 Length:112 Species:Danio rerio


Alignment Length:111 Identity:43/111 - (38%)
Similarity:67/111 - (60%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGTKLIYERAFMKNLRGSPLSQTPPSNVP 76
            :::.|:.||.:.:.|..|:|:.||.||||||:|||||||::||:|.|:.:.|.||:::|||    
Zfish     8 SKSCPIPTRVLHLKDWSQLPDCYSQTPGGTLFSTTPGGTRIIYDRKFLLDCRNSPIARTPP---- 68

  Fly    77 SCLLRGTPRTPFRKCVPVP-----TELIKQTKSLKIEDQEQFQLDL 117
             |.|...|........||.     .|.:::.|.|..:| .||::|:
Zfish    69 -CCLPQIPGVTIPSLHPVSKLQELKEELEEEKELAADD-SQFEMDI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 42/109 (39%)
eif4ebp3lNP_955977.1 eIF_4EBP 9..112 CDD:283183 42/108 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582449
Domainoid 1 1.000 81 1.000 Domainoid score I8429
eggNOG 1 0.900 - - E1_2CQCV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5190
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm25763
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5872
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.