DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thor and EIF4EBP1

DIOPT Version :9

Sequence 1:NP_001285588.1 Gene:Thor / 33569 FlyBaseID:FBgn0261560 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_004086.1 Gene:EIF4EBP1 / 1978 HGNCID:3288 Length:118 Species:Homo sapiens


Alignment Length:124 Identity:46/124 - (37%)
Similarity:71/124 - (57%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASPTARQAITQALPMITRKVVISDPIQMPE-VYSSTPGGTLYSTTPGGTKLIYERAFMKNLRG 64
            ||...:..|..::|:| .||:||:.|.:|:|. .||:||||||:|||||||::||:|.|:...|.
Human     1 MSGGSSCSQTPSRAIP-ATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRN 64

  Fly    65 SPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKIED------QEQFQLDL 117
            ||:::|||.::|:     .|..........|.|..:.......||      :.||::|:
Human    65 SPVTKTPPRDLPT-----IPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThorNP_001285588.1 eIF_4EBP 3..117 CDD:398880 43/120 (36%)
EIF4EBP1NP_004086.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/19 (32%)
eIF_4EBP 11..118 CDD:368450 42/112 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..48 14/22 (64%)
YXXXXLphi motif. /evidence=ECO:0000250|UniProtKB:P70445 54..60 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..118 13/58 (22%)
TOS motif. /evidence=ECO:0000269|PubMed:12747827 114..118 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148535
Domainoid 1 1.000 83 1.000 Domainoid score I8345
eggNOG 1 0.900 - - E1_2CQCV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5169
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1597535at2759
OrthoFinder 1 1.000 - - FOG0002674
OrthoInspector 1 1.000 - - otm42193
orthoMCL 1 0.900 - - OOG6_105200
Panther 1 1.100 - - LDO PTHR12669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5872
SonicParanoid 1 1.000 - - X1786
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.