Sequence 1: | NP_001285588.1 | Gene: | Thor / 33569 | FlyBaseID: | FBgn0261560 | Length: | 117 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004086.1 | Gene: | EIF4EBP1 / 1978 | HGNCID: | 3288 | Length: | 118 | Species: | Homo sapiens |
Alignment Length: | 124 | Identity: | 46/124 - (37%) |
---|---|---|---|
Similarity: | 71/124 - (57%) | Gaps: | 13/124 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSASPTARQAITQALPMITRKVVISDPIQMPE-VYSSTPGGTLYSTTPGGTKLIYERAFMKNLRG 64
Fly 65 SPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKIED------QEQFQLDL 117 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Thor | NP_001285588.1 | eIF_4EBP | 3..117 | CDD:398880 | 43/120 (36%) |
EIF4EBP1 | NP_004086.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 6/19 (32%) | |
eIF_4EBP | 11..118 | CDD:368450 | 42/112 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 25..48 | 14/22 (64%) | |||
YXXXXLphi motif. /evidence=ECO:0000250|UniProtKB:P70445 | 54..60 | 3/5 (60%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 64..118 | 13/58 (22%) | |||
TOS motif. /evidence=ECO:0000269|PubMed:12747827 | 114..118 | 1/3 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148535 | |
Domainoid | 1 | 1.000 | 83 | 1.000 | Domainoid score | I8345 |
eggNOG | 1 | 0.900 | - | - | E1_2CQCV | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 85 | 1.000 | Inparanoid score | I5169 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1597535at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002674 | |
OrthoInspector | 1 | 1.000 | - | - | otm42193 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_105200 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR12669 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5872 |
SonicParanoid | 1 | 1.000 | - | - | X1786 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.790 |